PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C026896P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 399aa    MW: 43149.1 Da    PI: 8.7003
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C026896P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.4e-344094155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wtp+LH+rFveav+qLGG++kAtPkt++++m+++gLtl+h+kSHLQkYRl
  MELO3C026896P1 40 KPRLKWTPDLHDRFVEAVNQLGGADKATPKTVMKIMGIPGLTLYHLKSHLQKYRL 94
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2673797IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-313895IPR009057Homeodomain-like
SuperFamilySSF466898.6E-173995IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-234095IPR006447Myb domain, plants
PfamPF002493.4E-94293IPR001005SANT/Myb domain
PfamPF143796.6E-23155201IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MYHHQHRGKS IHSSERHMFL QGGGNGGGGD SGLVLSTDAK PRLKWTPDLH DRFVEAVNQL  60
GGADKATPKT VMKIMGIPGL TLYHLKSHLQ KYRLSKNLHG QANGGSGTNK TGTVAVSVDQ  120
RLGEANGAAA AAAAARTNSI VVGPQPSSQS NKNLQISETI QMQIEVQKRL HEQLEVQRHL  180
QLRIETQGKY LQTVLEKAQE TLGRQNLGTV GLEAAKVQLS ELVSKVSTQC LTAAFPELHN  240
QSQSQRVCAQ QQSQPPDCSM DSCLTSSEGG SKDQQAAQQQ QQQQQVLLHN SHLALRPYAD  300
RASSGAPDHS LHGLSMSIGL VQGEKAGTEA YNGYSTSEGQ RLFGSKRTTK EAVLEKETGF  360
RYRMDLNNAG EDQLISSNSN NDHTSSTTCK MFDLNGFS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818390.0LN681839.1 Cucumis melo genomic scaffold, anchoredscaffold00114.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465332.10.0PREDICTED: chromatin modification-related protein EAF1 isoform X2
TrEMBLA0A0A0LG980.0A0A0A0LG98_CUCSA; Uncharacterized protein
STRINGPOPTR_0013s05670.11e-132(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-106G2-like family protein